PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0693s0012.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 248aa    MW: 26769.3 Da    PI: 8.6191
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0693s0012.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like521.6e-167362655
              G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         +AtPkti+++m+vkgLtl+h+kSHLQkYRl
  Kalax.0693s0012.5.p  7 EATPKTIMRTMGVKGLTLYHLKSHLQKYRL 36
                         7****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015573.1E-10637IPR006447Myb domain, plants
SuperFamilySSF466899.5E-6737IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-15737IPR009057Homeodomain-like
PfamPF143792.0E-2680126IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MFSYIAEATP KTIMRTMGVK GLTLYHLKSH LQKYRLGKQA GKESTENSKE ASCMAENQDT  60
GSSASPSSRV IAQEINDSYQ VTEALRLQMD VQRRLHEQLE VQRRLQLRIE AQGKYLQAIL  120
EKACKAFNDQ AAAAAGLEAA REELSGLAIK VSHDSQGLAP LDDLKMPSLS DITTTFASNS  180
QTAPNFPARL GDCSIDSCLT STGSPASPAG LTAQTASLKR RRRPMTGNGE SFPFPSMQAV  240
GWMPNSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217223LKRRRRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015574106.11e-120PREDICTED: myb family transcription factor APL isoform X2
RefseqXP_002300173.21e-119myb family transcription factor family protein
TrEMBLB9GFX51e-119B9GFX5_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0001s32200.11e-116(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-79G2-like family protein